PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID TRAES3BF063000030CFD_t1
Common NameTRAES_3BF063000030CFD_c1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family MYB
Protein Properties Length: 313aa    MW: 34232.9 Da    PI: 8.057
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
TRAES3BF063000030CFD_t1genomeIWGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding51.72e-164489147
                             TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
          Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                             rg W + Ed +l+++v q+G+ +W++Ia+++  gR++k+c++rw++ 
  TRAES3BF063000030CFD_t1 44 RGHWRPAEDARLKELVGQYGPQNWNLIAEKLD-GRSGKSCRLRWFNQ 89
                             899*****************************.***********996 PP

2Myb_DNA-binding569.1e-1896140147
                              TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
          Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                              r ++T+eE+++l  a++ +G++ W++Iar ++ gRt++ +k++w+ +
  TRAES3BF063000030CFD_t1  96 RRAFTEEEEDRLMAAHRAYGNK-WALIARLFP-GRTDNAVKNHWHVL 140
                              678*******************.*********.***********987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129417.1733990IPR017930Myb domain
SMARTSM007173.4E-134392IPR001005SANT/Myb domain
SuperFamilySSF466897.11E-2844137IPR009057Homeodomain-like
PfamPF002493.3E-154489IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.609.4E-264597IPR009057Homeodomain-like
CDDcd001671.39E-124788No hitNo description
PROSITE profilePS5129427.15591145IPR017930Myb domain
SMARTSM007171.0E-1495143IPR001005SANT/Myb domain
PfamPF002496.2E-1596140IPR001005SANT/Myb domain
CDDcd001671.17E-1198141No hitNo description
Gene3DG3DSA:1.10.10.609.3E-2198143IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010199Biological Processorgan boundary specification between lateral organs and the meristem
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0051782Biological Processnegative regulation of cell division
GO:0005634Cellular Componentnucleus
GO:0001046Molecular Functioncore promoter sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 313 aa     Download sequence    Send to blast
MAREMNGFFS HPPPPPPAPY QEEAAADVDD AEDGGGGQGK LCSRGHWRPA EDARLKELVG  60
QYGPQNWNLI AEKLDGRSGK SCRLRWFNQL DPRINRRAFT EEEEDRLMAA HRAYGNKWAL  120
IARLFPGRTD NAVKNHWHVL MARRQREQSG AFRRRTKPAS ASSSSSIAPA PHYAGVVLQH  180
QHQYQHHGAS PIPMPLQPFA MGVAIATGMY SKAATATASR AYSGGESDES ASTCTTDLSL  240
SSGNAAVPCF YHHQGYDMAP QAHAVTQAFS PSARSAFSAP SSSSARRQQQ QHEEEDGDKL  300
SLPFFDFLGV GST
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-32441447107B-MYB
1mse_C2e-32411441104C-Myb DNA-Binding Domain
1msf_C2e-32411441104C-Myb DNA-Binding Domain
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00222DAPTransfer from AT1G69560Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG6703060.0HG670306.1 Triticum aestivum chromosome 3B, genomic scaffold, cultivar Chinese Spring.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002457638.11e-120hypothetical protein SORBIDRAFT_03g010960
TrEMBLA0A077RZI10.0A0A077RZI1_WHEAT; Uncharacterized protein
STRINGMLOC_71066.11e-149(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP29438260
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69560.12e-70myb domain protein 105
Publications ? help Back to Top
  1. Brenchley R, et al.
    Analysis of the bread wheat genome using whole-genome shotgun sequencing.
    Nature, 2012. 491(7426): p. 705-10
    [PMID:23192148]